Total number of results for Didelphis virginiana are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02323 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMST
|
29 | Didelphis virginiana | Glucagon | Glucagon | 2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989). | |
| NP02652 |
LVNQHLCGSHLVEALYLVCGERGFFYTPKA
|
30 | Didelphis virginiana | Insulin | Insulin B chain | 2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989). | |
| NP02653 |
GIVEQCCNSICSLYQLETYCN
|
21 | Didelphis virginiana | Insulin | Insulin A chain | 2695899#Yu J.-H., Eng J., Rattan S., Yalow R.S.#Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.# Peptides 10:1195-1197(1989). |